We noticed that you're using an unsupported browser. The TripAdvisor website may not display properly.We support the following browsers:
Windows: Internet Explorer, Mozilla Firefox, Google Chrome. Mac: Safari.
Nearby Hotels
View Deal
  • Free Parking
  • Restaurant
Hotel Alpenruh(Murren)(Great Value!)
View Deal
Certificate of Excellence
  • Free Wifi
  • Breakfast included
Hotel Jungfrau(Murren)(Great Value!)
View Deal
Certificate of Excellence
  • Breakfast included
  • Restaurant
Mountain Hostel(Gimmelwald)
No availability for your dates from our partners
  • Free Wifi
  • Breakfast included
No availability for your dates from our partners
Certificate of Excellence
  • Free Wifi
Pension Gimmelwald(Gimmelwald)
No availability for your dates from our partners
  • Free Wifi
  • Restaurant
Hotel Regina(Murren)
View Deal
  • Free Wifi
  • Breakfast included
Certificate of Excellence
  • Free Wifi
  • Breakfast included
Reviews (103)
Filter reviews
103 results
Traveller rating
Traveller type
Time of year
LanguageAll languages
Show reviews that mention
All reviewsrick stevesthe cool mountain airswiss alpscow bellsglass windowscomfortable bedsbreadstayed two nightspension gimmelwaldtimvalleyhikinghikeshowercowsswitzerlandaccommodations
Updating list...
55 - 60 of 103 reviews
Reviewed 24 June 2013

We stayed here for three nights and had a great experience. The double room, shower, and bathroom areas were all clean and tidy. The breakfast of bread, jam, and cheese was a good start to the day. Tim is extremely knowledgable of the area and had excellent suggestions for hiking and knew the conditions of the trails. We felt very welcomed, starting with our initial email contact until we left at the end of our stay.

Room Tip: Front rooms have a better view but rear rooms are cheaper.
  • Stayed: June 2013, travelled with friends
    • Value
    • Location
    • Sleep Quality
    • Rooms
    • Cleanliness
    • Service
1  Thank sgs0720
This review is the subjective opinion of a TripAdvisor member and not of TripAdvisor LLC
Reviewed 15 June 2013

The hotel is up on the the hill. I'm sure our views would have been great, if the Alps were not cloud covered! The walls are THIN, the rooms are big. This is NOT a fancy place, but hanging out with other guests over dinner was a treat! (Definitely pre-order the dinner.) Tim was a fantastic host, helping us understand the culture of the life in a tiny village in the Alps. You have to pay for the showers. I suggest ear plugs - not just because of the thin walls, but the goats across the "road" have bells on their necks!

  • Stayed: May 2013, travelled as a couple
    • Value
    • Location
    • Sleep Quality
    • Rooms
    • Cleanliness
    • Service
1  Thank KGN86
This review is the subjective opinion of a TripAdvisor member and not of TripAdvisor LLC
Reviewed 14 June 2013

This hotel was definitely a highlight for our European trip. We spent three nights here. Like others have said the physical hotel is pretty good, but its the atmosphere that makes this place. If there are other travelers in the hotel you have to eat the dinner- we met some wonderful people and stayed up late into the night talking. The views are incredible and the town charming. Stop reading reviews and pull the trigger.

Stayed: June 2013, travelled as a couple
1  Thank Matthew F
This review is the subjective opinion of a TripAdvisor member and not of TripAdvisor LLC
Reviewed 4 June 2013

If you are looking for the charm of the Alps, good conversation and a slower pace this is the place. It is not the Ritz. Walter and Tim make you feel like a welcome guest in their home. Meals are family style where you swap stories of the days experiences and tomorrow's plans late into the night. The location is a wonderful gateway to all the activities the Alps offers. You can get a home cooked meal here or dine with younger drinking crowd down below (food in both locations is good), but definitely take your first meal with Walter as you may decide you have no need to eat elsewhere. Besides cook, manager, and maid, Tim is a great concierge with knowledge in all the trails, activities and weather. Hope to come back one day.

Stayed: June 2013, travelled with family
1  Thank JimDell
This review is the subjective opinion of a TripAdvisor member and not of TripAdvisor LLC
Reviewed 20 April 2013

We loved our stay here. Yes, we found it via Rick Steves and so all the other guests had done the same, but this one is a keeper.
Gimmelwald is a tiny hamlet amidst the Bernese Alps, with an incredible sweep of view across the valley to a mountain wall covered with cataracts. The gondola ride up from the valley floor is a joy in itself and then you are walking up Gimmelwald's one narrow road to the hotel. They serve dinner family style, alternating between two menus, and the sharing of stories with the other diners is part of the joy of the stay. Continuing the 'you are a guest in my home' motif, there are no room keys and the bath is down the hall. This hotel is for hikers and nature lovers, but would be a challenge for anyone with mobility issues, the stairs are steep (like the trails in the surrounding area). The sunsets that we watched from our over the front door balcony were truly epic. We'll be back.

  • Stayed: June 2012
    • Value
    • Location
    • Rooms
    • Cleanliness
    • Service
4  Thank Lksegal
This review is the subjective opinion of a TripAdvisor member and not of TripAdvisor LLC
View more reviews